PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA018621-PA
Common NameOsI_18828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 138aa    MW: 14777.9 Da    PI: 9.5674
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA018621-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.33.2e-3151101151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                       krien++nrqvtf+kRr g+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  BGIOSGA018621-PA  51 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101
                       79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.07143103IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-3943102IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-3045117IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004599IPR002100Transcription factor, MADS-box
CDDcd002654.99E-3945106No hitNo description
PRINTSPR004046.3E-334565IPR002100Transcription factor, MADS-box
PfamPF003199.9E-275299IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-336580IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-3380101IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APVASPGSGG SGGSGSVGAE KIGSRGKIEI KRIENTTNRQ  60
VTFCKRRSGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNRGKKWCTR VMHTLIIHDS  120
FASSSSIGGC PITSALGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-2045100358Myocyte-specific enhancer factor 2B
1tqe_Q7e-2045100358Myocyte-specific enhancer factor 2B
1tqe_R7e-2045100358Myocyte-specific enhancer factor 2B
1tqe_S7e-2045100358Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.480401e-174flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2620937641e-174
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321571e-172AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankAK1117231e-172AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
GenBankFJ7509421e-172FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.14e-56PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P12e-59MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLB9FN053e-98B9FN05_ORYSJ; Uncharacterized protein
TrEMBLB8AZ433e-98B8AZ43_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018621-PA8e-98(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.23e-38MIKC_MADS family protein